PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00135487001
Common NameGSBRNA2T00135487001, LOC106372182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 338aa    MW: 37938.5 Da    PI: 7.0092
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00135487001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.26.2e-071052440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         ++C+++ +   + +C+ ++ +lC +C  ++H        H++v
  GSBRNA2T00135487001 10 QTCDTCRSAACTVYCRADSAYLCTSCDAQIHAAnrlasrHERV 52
                         69******99*********************656788888876 PP

2zf-B_box35.71.8e-115297342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  GSBRNA2T00135487001 52 VRVCQSCERAPAAFFCKADAASLCTACDSQIHSAnplarrHQRVPI 97
                         689*****************************66899999**9997 PP

3CCT67.43.8e-23267311145
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                          R+a+++RY+eK+ktRkFeK+irY+sRK++Ae+RpR+KGrF+k++e
  GSBRNA2T00135487001 267 RKARVMRYREKKKTRKFEKTIRYASRKEYAEKRPRIKGRFAKRNE 311
                          9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.4E-9754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.779754IPR000315B-box-type zinc finger
CDDcd000212.10E-71254No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006434.1E-95297IPR000315B-box-type zinc finger
CDDcd000211.22E-95397No hitNo description
SMARTSM003361.9E-125597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648267309IPR010402CCT domain
PfamPF062032.3E-17267309IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MLKQEGNWAQ TCDTCRSAAC TVYCRADSAY LCTSCDAQIH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS QIHSANPLAR RHQRVPILPI SGSMVTNRSS ETTEAEDIVV  120
VGQEEEDEAE AASWLLPTSV KNCGDNNNNN NNSQDNRFSV GEEYLDLVDY SKYQQDYNVP  180
QRRSYVADGV VPLQVEVSKS LSHMHHEQHN FQFGFTNVSS EASPIHMVSL VPESTLSETT  240
VSHPRSPKAA MEELPEAPVQ MLSPMERKAR VMRYREKKKT RKFEKTIRYA SRKEYAEKRP  300
RIKGRFAKRN EVDAEEADKA FSSMVMFDTG YGIVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00135487001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2808680.0AY280868.2 Brassica napus putative beta-glucan elicitor receptor (Bger1), constans-like protein (CoL), and constans (Coa1) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013667797.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1-like
SwissprotO500551e-152COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A078C3900.0A0A078C390_BRANA; BnaA10g18420D protein
STRINGBra008668.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-131CONSTANS-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]